PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC195_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family STAT
Protein Properties Length: 622aa    MW: 70048.7 Da    PI: 4.4893
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC195_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1781.4e-552253361112
       STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypflea 100
                +dvvl+na+gqpv+kdv+vvasLlya+sg++vek++d eapLL+sydGvefs+ed+p++ll+G+as+klkisq  skcd+rLf+ikfeip+  +ypflea
  RrC195_p6 225 MDVVLSNAIGQPVRKDVQVVASLLYANSGTPVEKTSDLEAPLLVSYDGVEFSAEDKPCNLLNGCASLKLKISQHYSKCDKRLFCIKFEIPNKGSYPFLEA 324
                69************************************************************************************************** PP

       STAT 101 vskpirCisrsr 112
                v++++rCisr+ 
  RrC195_p6 325 VTNQMRCISRTT 336
                **********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2008.6E-427146IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133855.4E-728174No hitNo description
SuperFamilySSF498991.74E-729166IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103384.38E-67517622No hitNo description
Gene3DG3DSA:3.30.505.103.8E-8525576IPR000980SH2 domain
SuperFamilySSF555505.45E-12525613IPR000980SH2 domain
PROSITE profilePS500019.959528581IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MADDCALDTE KYSLLEDFNV DVEVGKQEFE TFSLCFWVYL LDSTTYPSTI IRQVHSDMSF  60
SAPFLVLDEN KKMILLPLTL LHKEAPDPVN TASWTEVPNV STTAEFPLQK WVHVGCEVSR  120
TYMRLYICGE IAGEKVLTSV MTNGTNSDYV RRRVSLFSVG GDGYSVQGFI HCAEVLPSTL  180
HVNNHYTKDP PLWLSVEKPS SCEIDEDGVW SIVGEKASCG MIFSMDVVLS NAIGQPVRKD  240
VQVVASLLYA NSGTPVEKTS DLEAPLLVSY DGVEFSAEDK PCNLLNGCAS LKLKISQHYS  300
KCDKRLFCIK FEIPNKGSYP FLEAVTNQMR CISRTTGGDS VTPKRLNHPL VEGGGVPSSN  360
GASDTSLSMK RIKLGEEKIP EREFEDGNGT SMEWRPQRHD DEEEEEEEEE EEEEEEDHSS  420
TDSENTEVRG STGSRKYTIS DSMIFRYCLG NLTERSLLLK EVTNNSGDEE VSEFADQDFE  480
LLRRICGCYD YITQENFERM WCWLFPVATA ISSRGLINGM WRSCSPKWIE GFVTKEEAEH  540
SLQSQEPGTF ILRFPTSRSW PHPDAGSLVV TYVGHDFVIR HRLLAVDHIC DSSERYTDAK  600
PLQDMLLAEP ELSRLGRIVR SI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366373LSMKRIKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660439.10.0PREDICTED: uncharacterized protein LOC106365559
RefseqXP_013660441.10.0PREDICTED: uncharacterized protein LOC106365559
RefseqXP_013660442.10.0PREDICTED: uncharacterized protein LOC106365559
TrEMBLA0A078HNA30.0A0A078HNA3_BRANA; BnaC05g13150D protein
STRINGfgenesh2_kg.7__3481__AT1G17040.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A